PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G221400.1.p
Common NameGLYMA_12G221400, LOC100784578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 376aa    MW: 41277.2 Da    PI: 9.1364
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G221400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.92e-53151421128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra++sgyWkatg+dk
  Glyma.12G221400.1.p  15 LPPGFRFHPTDEELVVHYLKKKTASAPLPV-AIIAEVDLYKFDPWELPAKAAFGEQEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDK 103
                          79****************************.88***************988899************************************ PP

                  NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +vl++ ++++vg+kk Lvfy g+ p+g kt+W+mheyrl
  Glyma.12G221400.1.p 104 PVLTSgGTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRL 142
                          ***9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-649177IPR003441NAC domain
PROSITE profilePS5100561.78115177IPR003441NAC domain
PfamPF023654.8E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGSTDSSSGS QQPNLPPGFR FHPTDEELVV HYLKKKTASA PLPVAIIAEV DLYKFDPWEL  60
PAKAAFGEQE WYFFTPRDRK YPNGARPNRA ATSGYWKATG TDKPVLTSGG TQKVGVKKAL  120
VFYGGKPPRG IKTNWIMHEY RLADNKPNNR PPPGCDLGNK KNTLRLDDWV LCRIYKKSNT  180
HRSPMEHERE DSMDDMIGGI PPSINVGHMS ARFHHLSKMT TAYNSGAMLE NEHNLLEGMM  240
IGNNNGGMNT TTTATTTPGA MSSHLGGSKA ELSFVPTMTH SSNTSKRTLS SLYWNDEDVT  300
GTSSSNRRFN LESGDNNNHG SVVRADQENG TASSIATLLN QLPQTPSLHQ QSMLGSIGDG  360
LLRTTYQIPG MNWYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-7611791170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.228510.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619160.0EU661916.1 Glycine max NAC domain protein (NAC16) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540450.10.0PREDICTED: NAC transcription factor 56-like
SwissprotQ9LD441e-123NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0B2R2X90.0A0A0B2R2X9_GLYSO; NAC domain-containing protein 18
TrEMBLI1LUX80.0I1LUX8_SOYBN; Uncharacterized protein
STRINGGLYMA12G34990.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-119NAC domain containing protein 2